Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Anti-CAPN15 Mouse Monoclonal Antibody [clone: 4E2]

Supplier: US Biological
Recommended dilution: Immunofluorescence: 10 μg/ml

Type: Primary
Antigen: CAPN15 (calpain 15)
Clonality: monoclonal
Clone: 400
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human



Log in to see your contract pricing and availability.
  Remember me on this device
 

ORDER

Expand All / Collapse All
Size Pk VWR Catalog Number Quantity
100 µg 100 µG USBI133700
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFICATIONS

Antigen symbol CAPN15
Antigen name calpain 15
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 4E2
Host Mouse
Isotype IgG2a kappa
ELISA Yes
ImmunoFluorescence Yes
Amino acid number 993 to 1087
Purification purified by Protein A chromatography
Sequence HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL*
Form liquid
Storage buffer PBS, pH 7,2.
Storage temperature Cool
Shipping temperature Ice
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory. Enter 'x' if unknown for VWR Chemicals

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Or
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty