Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Anti-SPOP Mouse Polyclonal Antibody

Supplier: US Biological
Recommended dilution: Immunofluorescence: 10 μg/ml

Type: Primary
Antigen: SPOP (speckle-type POZ protein)
Clonality: polyclonal
Clone:
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG
Reactivity: Human



Log in to see your contract pricing and availability.
  Remember me on this device
 

ORDER

Expand All / Collapse All
Size Pk VWR Catalog Number Quantity
50 µg 50 µG USBI133793
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFICATIONS

Antigen symbol SPOP
Antigen name speckle-type POZ Protein
Reactivity Human
Conjugation Unconjugated
Clonality Polyclonal
Antibody type Primary
Host Mouse
Isotype IgG
Western blot Yes
ImmunoFluorescence Yes
Amino acid number 1 to 374
Purification purified by Protein A chromatography
Sequence MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
Form liquid
Storage buffer PBS, pH 7,2.
Storage temperature Cool
Shipping temperature Ice
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory. Enter 'x' if unknown for VWR Chemicals

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Or
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty