Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Anti-AMMECR1 Mouse Monoclonal Antibody

Supplier: Abnova
Mouse monoclonal antibody raised against a full-length recombinant AMMECR1.

Type: Primary
Antigen: AMMECR1
Clonality: Monoclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human



Log in to see your contract pricing and availability.
  Remember me on this device
 

ORDER

Expand All / Collapse All
Size Pk VWR Catalog Number Quantity
Up to 5 Clones 1 ABNOH00009949-M
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFICATIONS

Antigen symbol AMMECR1
Antigen name Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Host Mouse
Western Blot Yes
ELISA Yes
Antigen synonyms AMMERC1
Amino acid number 1 to 296
Gene ID 9949
Format Liquid
Cross Adsorption No
Immunogen AMMECR1 (NP_001020751.1, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTLSPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYCHLYGYQQPRTPRFTNEPYALKDSRFPPMTRDELPRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory. Enter 'x' if unknown for VWR Chemicals

Enter Certificate Details

Select Product:

Enter the Lot number:

Choose from recent batch/lot numbers:

Or
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty