Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Anti-NKX2-2 Rabbit Polyclonal Antibody

Supplier: Abnova
Rabbit polyclonal antibody raised against recombinant NKX2-2.

Recommended Dilutions: Immunohistochemistry: 1:50-1:200; Western Blot: 1:250-1:500

Type: Primary
Antigen: NKX2-2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human



Log in to see your contract pricing and availability.
  Remember me on this device
 

ORDER

Expand All / Collapse All
Size Pk VWR Catalog Number Quantity
100 μl 100 µl ABNOPAB20216
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFICATIONS

Antigen symbol NKX2-2
Antigen name NK2 homeobox 2
Reactivity Human
Conjugation Unconjugated
Clonality Polyclonal
Antibody type Primary
Host Rabbit
Isotype IgG
Western Blot Yes
ImmunoChemistry Yes
Antigen synonyms NKX2C, NKX4-3, NKX2.3, NK2.3, CSX3
Gene ID 4821
Format Liquid
Cross Adsorption No
Immunogen Recombinant protein corresponding to amino acids of human NKX2-2.
Purification Antigen affinity purification
Sequence SLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETP
Storage Buffer PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
Storage temperature Store at 4 °C. For long term storage store at – 20 °C. Aliquot to avoid repeated freezing and thawing.
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory. Enter 'x' if unknown for VWR Chemicals

Enter Certificate Details

Select Product:

Enter the Lot number:

Choose from recent batch/lot numbers:

Or
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Catalog Number Availability Unit Your Price Price Per Qty